The world's premier anti internet scam, anti fraud information website 

  • [email protected]

  • 419 scam database with 50,000+ reports. Verify suspicious inheritance emails, lottery wins, and money transfer requests. Names, emails and bank details exposed.
Who are you really talking to? Check their location - InfoSniper
419 scam database with 50,000+ reports. Verify suspicious inheritance emails, lottery wins, and money transfer requests. Names, emails and bank details exposed.
  Been Targeted by This Scam?

Learn how to report a scam to the FBI, FTC, and the right authorities. Been asked to invest in crypto? Read about pig butchering scams. Received a suspicious check? Learn about fake check scams. Not sure if it's real? Use our free Scam Checker Tool.

  by Reportandie
 
Delivered-To: [my.redacted.address]
Received: by 10.194.23.98 with SMTP id l2csp71619wjf;
Mon, 28 Jan 2013 15:39:35 -0800 (PST)
X-Received: by 10.14.219.72 with SMTP id l48mr67576eep.37.1359416374226;
Mon, 28 Jan 2013 15:39:34 -0800 (PST)
Return-Path: <[email protected]>
Received: from mail6.ukrpost.ua (mail6.ukrpost.ua. [82.207.79.6])
by mx.google.com with ESMTP id h41si15742860eem.252.2013.01.28.15.25.57;
Mon, 28 Jan 2013 15:39:34 -0800 (PST)
Received-SPF: pass (google.com: domain of [email protected] designates 82.207.79.6 as permitted sender) client-ip=82.207.79.6;
Authentication-Results: mx.google.com;
spf=pass (google.com: domain of [email protected] designates 82.207.79.6 as permitted sender) smtp.mail=[email protected]
Message-Id: <51070c36.c1b30e0a.4a8f.ffff8445SMTPIN_ADDED_MISSING@mx.google.com>
Received: from [85.183.16.152] (helo=User)
by mail6.ukrpost.ua with esmtpa (Exim 4.74)
(envelope-from <[email protected]>)
id 1Tzy5L-0003Lv-Ns; Tue, 29 Jan 2013 01:25:56 +0200
Reply-To: <[email protected]>
From: "Ahmed Al Ansari"<[email protected]>
Subject: Re: Important Proposal
Date: Tue, 29 Jan 2013 00:26:03 +0100
MIME-Version: 1.0
Content-Type: text/html;
charset="Windows-1251"
Content-Transfer-Encoding: 7bit
X-Priority: 3
X-MSMail-Priority: Normal
X-Mailer: Microsoft Outlook Express 6.00.2600.0000
X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000
X-Drweb-SpamState: yes
X-Drweb-SpamScore: 560
X-DrWeb-SpamReason: gggruggvucftvghtrhhoucdtuddrfeehledrkeeiucetufdoteggodetrfcurfhrohhfihhlvgemuceonhhonhgvqeenuceurghilhhouhhtmecupfdsteenucfjughrucdvfedtucdlvddttddmnehmihhsshhinhhgucfvqfcufhhivghlugculdeftddmnegopfhokfffucdluddtmdenogevhihrihhllhhitgdqqdfntfdqqdfgmhhpthihkfffucdlvddtmdennddoufgtrghmhidqofhonhgvhidqfhhrqdgvnhculdeftddtmd
X-Antivirus: Dr.Web (R) for Unix mail servers drweb plugin ver.6.0.0.0
X-Antivirus-Code: 0x100000

From The Desk Of
Mr.Ahmed Al Ansari,
Branch Manager
National Bank of Abu Dhabi
Dibba Al Hisn Al Aqd Al Fareed Street,
opposite Dibba Al Hisn Court,
Plot No. 411 2440677 2440622 144900
Qidfaa Branch Main Street Between Korfakkan
& Fujairah Building Khalifa Matar
Email: [email protected]


Friendly greetings to you.

Let me start by introducing myself. I am Ahmed Al Ansari, the Branch Manager of National Bank of Abu Dhabi. I have urgent and very confidential business proposition for you. An American Iraqi Foreign Oil Consultant /Contractor with the Chevron Petroleum Corporation Company named Late Mr. Thomas Stone made a numbered time (Fixed) Deposit for twelve calendar months, valued at US$12,000,000.00 (Twelve Million) United State Dollars in my branch. Upon maturity, I sent a routine notification to his forwarding address but got no reply. After a month, we sent a reminder and finally we discovered from his contract an employer that is the Iraqi Foreign Oil consultant confirmed to us that he was actually dead.

Before the time of his death, he had on a visit to my branch office confided in me that no one except me knew of his deposit in my bank. Therefore, Twelve million United State Dollars is still lying in my bank and no one will ever come forward to claim it. It is against this backdrop that my suggestion that I would like you as a foreigner to stand as the next of kin to Thomas Stone so that you will be able to receive his funds for our mutual benefit. We will share the fund at the ration of 60% for me while 40 % for you.

There is no risk at all as all the paperwork for this transaction will be done by the attorney and my position as the Branch Manager guarantees the successful execution of this transaction. If you are interested, please kindly reply to this email immediately. Upon receiving your response, I shall then provide you with more details and relevant documents that will help you understand the transaction. Please send me your confidential telephone and fax numbers for easy communication. Also I wish for you to please observe utmost confidentiality over this proposition, and be rest assured that this transaction would be most profitable for both of us at the end, provided we both work hand in hand to achieve success.

Your earliest response to this email would be greatly appreciated, i request that you send me to me bellow details;

(1) your direct mobile/fax number.
(2) Your name and country resident address.
(3) Your private E-mail box.
(4) Your Occupation

Regards,

Ahmed Al Ansari.